최근 수정 시각 : 2025-04-21 02:06:50

엔도르핀

1. 호르몬
1.1. 어원과 역사1.2. 용도와 사례1.3. 창작물에서
2. 태국의 모던 록밴드3. BEMANI 시리즈의 수록곡4. 엔돌핀(인터넷 방송인)5. 게임 개발사6. 음악 유닛 Endorfin.

1. 호르몬

Endorphin

외래어 표기법에 따르면 r은 '르'로 발음되므로 엔도르핀이 맞는 표기다. 하지만 '엔돌핀'으로 표기하는 경우가 흔하다.

파일:b-endorphin.png
베타 엔도르핀의 구조식

베타 엔도르핀의 화학식 C,158,H,251,N,39,O,46,S, 아미노산 서열 YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

엔도르핀의 종류는 크게 세 개인데 α-엔도르핀, β-엔도르핀, γ-엔도르핀 이렇게 세 가지가 있다. 보통 우리가 일상에서 말하는 엔도르핀은 베타 엔도르핀을 의미한다.

인체에서 자체 생산하는 매우 강력한 오피오이드이자 스트레스 호르몬. 동물에서 분비되는 내인성 오피오이드 펩타이드(Endogenous opioid peptide)[1] 중 한 종류.

1.1. 어원과 역사

이름의 뜻은 내인성[2] 모르핀(endogenous morphine)이라는 뜻인데, 실제 효능은 모르핀의 약 800배다.[3]모르핀의 200배에 달하는 진통 효과를 가진 펜타닐도 상대가 안 된다.[4]

1973년, 애버딘 대학교(University of Aberdeen)의 신경학자 존 휴즈(John Hughes, 1942 ~ )와 화학자 한스 발터 코스털리츠(Hans Walter Kosterlitz, 1903 ~ 1966) 등의 연구자들에 의해 처음 발견된 것으로, 발견 동기는 아편이 쾌감을 주는 원인을 연구하기 시작하면서이다. 연구 과정에서 에 아편 수용체(opioid 수용체)가 있음을 밝혀낸 과학자들이 이 수용체에 대응하는 원래의 뇌내 분비물질을 연구하여 발견한 것이 엔케팔린(enkephalin)이라는 펩타이드였으며, 그 후 엔도르핀이 발견된다.

1.2. 용도와 사례

주로 인체통증으로 인해 발생하는 쇼크작용으로 부터 생명을 보호하기 위하여 분비된다. 엔도르핀은 인체가 쇼크로 인한 죽음의 위협 앞에서 개체의 생존을 위해 발동시키는 최후의 수단이다. 흔히 만화영화에서는 단시간동안 통증을 무시하고 전력으로 싸우거나 도망칠 수 있게 해주는 가상의 약물이 등장하는데, 그 약물과 같은 역할을 하는 것이 바로 엔도르핀이다. 비록 인간의 쾌락욕 때문에 엔도르핀 수용체에 때려박을 수 있는 화학물질이야 많이 개발됐지만 하나같이 호흡정지 및 의식상실이라는 생명 활동에 치명적인 부작용이 있어서, 아무리 진통 효과가 높은들 엔도르핀만큼 뛰어난 진통 효과를 보이는 물질은 없다.[5] 어지간해선 분비량이 적으니 문제일 뿐.[6]

생존을 위해 지구력 운동을 하는 모든 야생 동물은 엔도르핀 부스터의 유무로 생존율이 크게 차이가 나게 되기 때문에 스트레스 상황에서 자연히 아드레날린과 함께 엔도르핀이 분비되도록 진화되었다. 예를 들어서 사바나에서 육식동물이 초식동물을 잡아먹으려고 하는 상황 속에서는, 근육이 손상되더라도 젖을 먹던 힘까지 짜내서 더 무리할 수 있는 쪽이 도주에든 사냥에든 성공할 것이므로 더 생존률이 높은 게 당연하다. 사망 직전의 엔도르핀 대량 분비는 일종의 부작용. 비록 부작용이긴 하지만 죽어가는 동물에게 신체가 마지막 자비를 베푼 것이라고 볼 수 있다. 엔도르핀이 없으면 죽을 때까지 고통을 끝까지 느껴야 하기 때문이다. 그러므로 엔도르핀은 부작용인 동시에 야생 동물이 비교적 편하게 갈 수 있도록 도와주는 것이라고 볼 수 있다. 실제로 사냥 방식이 쇼크사를 일으키는 방식인 하이에나를 제외한 사자 등에게 사냥 당한 직후 아프리카물소 등의 야생동물의 얼굴을 자세히 보면 어느 정도는 평온한 표정을 짓고 있다는 걸 알 수 있다. 사람 역시 마찬가지라 죽음에서 한 끗발 차이로 살아남은 임사 체험의 생존자들이 말하는 '육체적인 고통이 없어지며 편안한 상태를 느꼈다'는 증언들도 무관하지 않을 것이다.

즉, 엔도르핀은 당장 통증만으로도 정신이 오락가락해서 내일의 건강을 생각할 겨를이 없는 막장 상황을 어떻게든 견디기 위해 나오는 것에 가깝기 때문에 엔도르핀이 마구 나올만한 상황은 가급적 겪지 않는 게 육체 및 정신 건강에 유익하다. 엔도르핀이 폭발적으로 분비되는 대표적인 경우 세 가지가 있는데, ①사망 직전 ②출산 ③급작적 중상이다. 하마에게 물리거나 기타 야생동물의 공격으로 팔다리 중 하나가 떨어져나간 후 도망가면서 고통을 못 느꼈거나, 에 맞고 도망칠 때 고통이 느껴지지 않았다거나, 자동차 사고 등으로 치명상이나 중상을 입었을 때 부상을 입은 부위에 고통이 느껴지지 않는 경우나, 자살시도를 했다가 극적으로 생존한 사람이 소생 직전에 격한 환희를 느꼈다고 한다거나, 엄마들이 흔히 자식한테 너 낳을 때 기뻤다고 하는 이야기들이 엔도르핀의 효과다. 어쨌거나 엔도르핀은 평소의 일상적인 고통을 줄일 때도 극소량씩 분비되지만 과량 분비는 최후의 수단이므로 조건이 매우 빡빡한데 3도 화상이나 말기암, CRPS, 환상통 같은 통증으로 식은땀 뻘뻘 흘리며 소리 지를 정도(?)로는 안 나온다. 심지어 호흡을 곤란케 할 정도인 외과질환 통증의 끝판왕이라는 요로결석으로도 엔도르핀의 폭발적 과분비는 일어나지 않는다.[7] 위 상황은 아이러니하게도 생존에 필수적인 고통이라고 뇌가 인지하기 때문이다. 즉 뇌가 생명에 치명적인 위협으로 인지할 수 있는 절단상, 관통상 등 급작스러운 치명상 정도는 되어야 분비되는 것이다.

사실 평상시에도 분비는 되지만 그 양은 지극히 소소하다. 이는 움직이기만 해도 생기는 쓸모없는 자잘한 통증신호들을 무시하기 위해 분비되는 것이기 때문이다. 운동을 할때도 분비가 되는데, 과정은 운동을 하면 스트레스 신호가 생기고 이로인해 엔도르핀이 분비된다. 이 과정으로 운동중에 생기는 근육통이나 각종 열상으로 인한 무력화를 막아주어 끝까지 운동을 할 수 있게 해준다. 아플 수밖에 없을만큼 오래 운동을 하면 살갗이 나뭇가지나 풀에 긁혀도 당장은 아프지 않다던가, 운동한 당일은 안 아팠는데 하룻밤 자고 일어나니 너무 아파서 걷지도 못하게 된다던가 하는 것이 바로 엔도르핀의 진통효과 에서 기인한 것이다. 웨이트 트레이닝에서도 마찬가지로 작용하기에 오랜만에 중량을 치고 난 당일은 괜찮은데 다음날 알이 배긴다던가, 알이 배겨서 아프지만 움직이면 통증이 가신다던가 하는 것도 마찬가지. 즉 헬스든 보디빌딩이든 파워리프팅이든 근육의 성장을 위한 단련에 있어서 엔도르핀이 필수적이다. 엔도르핀이 없다면 너무 이른 근육통으로 인해 정해진 주기로 정해진 중량을 치면서 충분한 자극을 줄 수 없을 것이다.

그 외에 모기 물린 곳이 가려워서 긁을 때 피부가 까지고 피가 나는데도 나중에서야 쓰라린 걸 깨닫는 이유도 엔도르핀의 진통효과 때문이다. 모기에 물렸거나 해서 가려움증이 느껴질 때 그 부분을 긁은 강도를 기억해 뒀다가 생살에다 똑같이 긁어 보면 엔도르핀의 진통 효과가 어느 정도인지 몸소 느껴볼 수 있다.

다급한 상황에서 사람이 인간을 초월한 힘을 발휘했다는 사례도 이 엔도르핀의 작용으로 일부 설명할 수 있다. 위의 각주에도 나오지만 엔도르핀이 나올만한 상황에서는 아드레날린도 거의 같이 분비되기 때문. 비상상황에서 효과적으로 생존/도피하기 위해서 엔도르핀으로 통증을 차단해버리면 몸이 근육관절의 한계를 체감하지 못하게 되고 여기에 아드레날린의 효과가 더해져 폭발적인 근력 출력을 내는 것. 물론, 감각만 차단할 뿐 조직의 손상을 막는 건 아니기 때문에 다치고 후유증을 남길 것이다. 이런 특성 때문에 인간리미터 해제로 비유하기도 한다.

매운맛이 중독성을 가진 이유도 엔도르핀 등[8] 때문이라는 이 유력하다. 실제로 매운맛은 맛이 아니라 입안 세포들이 느끼는 일종의 통증(통각)이기 때문에, 그 통증에 대해 반사적으로 엔도르핀이 분비되다 보니 여기에 중독된다는 것. 마찬가지로 사정을 할 때 쾌감과 함께 통감을 느끼는 것도 이와 같은 현상이다. 이런 식이면 마조히즘자해 역시 이걸로 설명 가능하다.[9]

실제로 엔도르핀 때문에 마라톤 등의 장거리 달리기에 중독되는 러너스하이라는 현상도 있거니와, 잘못 사용하면 크게 다치거나 죽을 수도 있다. 오버트레이닝으로 관절이나 힘줄을 무리하게 써서 회복하기 힘든 손상을 입을 수도 있고, 특히 현대에는 과학적으로 근육 자극과 지방 연소의 효율을 최대한 높인 운동방법이 발달한 나머지 과량의 아드레날린과 조합된 천연 스팀팩을 맞은 채로 체력의 한계의 한계까지 쥐어짜는 운동을 하다가 횡문근융해증에 걸려 평생 신부전 후유증에 시달릴 수도 있기 때문에 당장 안아프다고 해서 운동을 무리하게 해서는 안된다.

남유럽해수욕장 등에선 젊은 여성들이 상의를 탈의한 상태로 선탠하는 경우를 어렵지 않게 발견할 수 있다. 특히 스페인이 그렇고 그리스의 경우 유명 섬 관광지에서 흔하다. 동양인 입장에서는 왜 저네들은 다 벗고 선탠할까 기겁하지만, 원래 유럽백인들의 경우 선탠하면서 햇빛을 쬐면 상당한 수준의 베타 엔도르핀이 생성되는데, 동양인들의 경우 햇빛 쬔다고 특별히 유럽인처럼 베타 엔도르핀이 막 생성되지는 않는다. 동양인 입장에서는 이해 잘 안되는 게 당연하다.[10]

한편, 한국에서는 엔도르핀은 즐거울 때 나온다는 잘못된 통념이 존재하는데, 이는 이상구 박사가 1990년대 초에 TV, 강연 테이프 등을 통해 '기쁘고 즐거우면 몸에서 엔도르핀이라는 좋은 호르몬이 생성되고 화가 나고 스트레스를 받으면 아드레날린이라는 나쁜 호르몬이 생성된다'는 유사과학 정보가 담긴 강연을 하여 선풍적인 인기를 끌었기 때문이다. 이로 인해 아드레날린은 실제로 스트레스 상황에서 분비될 수 있지만, 그것과 별개로 '나쁜 호르몬'이라는 오명을 뒤집어쓰게 되었다. 이 이론이 온갖 사이비들에게 확대재생산되어 심지어는 '기쁘지 않아도 억지로 웃으면 몸에서 엔핀이 생성되어 건강해진다'는 주장을 하는 '웃음체조'따위가 나오는 밑거름이 된다. 하지만 웃을때 엔도르핀이 나온다는 것은 허무맹랑하다는 식의 결론도 사실과 맞지 않는다.

당연하지만 인체에서 만들어지는 것이기 때문에 인체에서 검출돼도 뭐라 태클을 걸 수 없을테니 인공적으로 합성하여 마약으로 만들면 넘사벽스러운 효과가 나올 것 같다는 의견이 있다. 유사한 물질로 엔케팔린이 있는데, 엔도르핀이 뇌내에서 작용한다면 엔케팔린은 척수에서 작용하는 정도의 차이가 있다. 엔도르핀이라 하면 둘 다를 포함할 때도 있다. 그런데 엔도르핀을 인공적으로 만들더라도 위 그림을 보듯 분자량이 큰 나머지 혈뇌장벽을 넘지 못한다. 즉, 엔도르핀을 마약으로 쓰려면 뇌에다가 카테터를 개통해서 직접 분사하는 방법밖에 없는데, 누가 이런 목숨까지 위험할 개뻘짓을 감행할 것인지는 의문. 애초에 마약이, 목숨 걸고 하는 거긴 하다만...

1.3. 창작물에서

  • House M.D.: 시즌4 3화에 사고를 당해 심장이 멈췄던 순간이 인생에서 가장 행복한 97초였다며 병원에서[11] 계속 자살을 시도하는 환자가 나오는데,[12] 이 환자가 엔도르핀에 중독된 것으로 보인다. 근데 이 환자는 결국 죽었다.
  • Star Trek : Deep Space Nine: 개랙은 고문을 견딘다는 목적으로 두뇌에 엔도르핀 분비를 촉진하는 임플란트를 시술받았다. 그런데 유배지인 DS9의 생활이 고문같아서 임플란트를 계속 가동시키다가 그만 고장이 나서 고통을 유발해버린다.
  • 격기3반: 차소월이라는 캐릭터가 엔도르핀을 선천적으로 많이 분비하여 소위 광전사 내지로 불리는 특징인 싸우면 싸울수록 강해지고 고통에 흥분하는 캐릭터로 등장한다.
  • 그래플러 바키: 바키는 귀를 잡아 돌리는 것만으로도 뇌내에서 자유로이 엔도르핀을 조절했다. 과연 비범하다. 레츠 카이오는 중국권법에서 이 엔도르핀의 생산을 일상화시키는 전통이 있다고 하며, 같은 상태의 바키를 압도했다.
  • 다크세이버: 엔돌핀은 '퀵' 효과를 주는 소모품이었다. 전직한 캐릭터들은 '퀵 링'을 착용하지 못하기에, 전투에 돌입할 때마다 엔돌핀을 소모해야 했다.
  • 다크 엔젤: 돌프 룬드그렌 주연의 1990년 영화로 사람에게 헤로인을 대량 투여한 뒤에 뇌에서 엔도르핀을 채취해가는 외계인 연쇄살인마가 등장한다.
  • 블랙 잭 극장판: 작중 등장하는 가상의 질병 모이라 증후군은 뇌하수체에 모종의 종양을 만들고 엔도르핀을 수십 배가 넘게 이상 발생시키는 바이러스성 질병으로, 이 질병에 걸린 사람들은 여러 분야에서 초월적인 기량을 선보이며 세간에서 '초인류' 라고 불리며 칭송받았지만 시간이 지나서 과도한 엔도르핀 생성으로 인한 부작용으로 전신에 식은 땀이 흐르는 증상을 보이다 다발성 장기 부전으로 비참하게 사망하거나 혹은 엔도르핀 자극으로 주체하지 못하는 신체 능력으로 인해 죽어버리는 비참한 죽음을 맞이했다. 주인공 블랙 잭도 이 질병에 감염되어 잠시 생사를 오갔다.
  • 슈퍼닥터 K: 두뇌에 전자자극을 주어 엔도르핀 생산을 증가시키는 기계가 나왔다. 비슷한 것으로 베르나르 베르베르의 소설 와 TRPG 섀도우런에서 관련 설정이 등장한다. 섀도우런에서는 한 술 더 떠서 엔도르핀 임플란트에 중독된 환자가 고통을 일부러 유발시키기 위해 치아를 부수거나 손톱을 잡아 뜯는(!) 사례를 소개하고 있다.
  • 스타크래프트: 강력한 합성 엔도르핀아드레날린을 신경 증폭 물질과 혼합한 전투 자극제가 존재하며 스타크래프트 시리즈테란 보병 유닛들 중 해병(스타크래프트 시리즈), 화염방사병(스타크래프트 시리즈), 불곰이 사용하며 설정상 사신밴시도 사용한다.
  • 심슨 가족: 호머가 분쟁지역에 전화를 했다는 사실에 자신의 뇌와 대화를 나눈다. 그러나 호머는 자신이 전화를 했다는 것을 확실시하지 못해 마지한테 물어보려고 하자 호머의 뇌가 그냥 수표결제 해버리면 엔도르핀을 보내준다고 말한다.
  • 용과 같이 OF THE END: 좀비 바이러스 "타나토스"는 감염자의 신체에 대량의 엔도르핀 분비를 유도하는 바이러스. 감염될 경우 너나 할 거 없이 엔도르핀 때문에 "기분 좋아..."를 외치면서 개발자인 DD 말마따나 "감미로운 죽음"을 맞고 좀비나 변이체(투여기로 직접 주입당했을 경우)로 화한다.
  • 유미의 세포들: 주인공인 김유미가 개빡치거나(...) 몹시 흥분할 때마다 뇌내 마을을 기습 방문해서 콘서트를 여는 록밴드로 묘사되었다. 밴드 멤버 셋의 이름도 그룹명에 맞게 '앤', '도르', '핀'이다.
  • 흑랑가인: 홍정훈의 패러디 반무협소설로 최종 보스 동방박사가 이걸 무공으로 사용한다. 진!행복극락신장으로 빛의 형태로 발사되며, 맞은 사람의 뇌의 염돌편이 과다 분비 되어서 마약중독 비슷한 상태가 되어 굴복하게 된다. 빛의 형태이므로 가드 불가. 사실 엄청 나게 효과가 강한 것은 아닌데, 워낙에 무협소설의 내공 과다 캐릭터들이라 몸이 고생해서 수련한 적도 없고, 수련과정에서 엔도르핀이 자동 분비된 적도 없어서 내성이 엄청 약하다라는 이유로 픽픽 쓰러져 나간다는 설정이다. 무식한 외공을 수련한 주인공은 상대적으로 내성이 있다는 참으로 과학적 설정.
  • 휴먼버그대학교:코사카 신타로가 칸텔전쟁 최종전에서 기존에 입었던 중상들을 엔도르핀을 컨트롤 하면서 통증을 완화하는 모습을 보여줬고.통증이 완화된 덕분에 다비츠를 상대로 승리하는데 성공하였다.

2. 태국의 모던 록밴드

เอ็นโดรฟิน / Endorphine

태국록밴드. 태국의 방콕에서 서로 중학교 친구였던 기타리스트인 키아와 드러머인 밤을 중심으로 결성 및 데뷔하였다. 그 후 베이시스트인 버드가 영입. 후에 버드의 추천으로 보컬인 다가 영입되어 지금까지 왕성한 활동을 하고 있다.

2004년도 발매한 첫 번째 정규앨범인 Prik(พริก)(2004)를 발매한 후부터 태국의 차트를 휩쓸며 태국 내 최고가의 인기를 자랑하고 있는 밴드 중 하나이다.

대한민국의 태국여행 관련 사이트를 돌아다녀봐도 가장 유명하고 인기 있을 정도로 한국에서 태국의 뮤지션 중에서는 가장 유명세를 탄다.

보컬리스트 다는 '다 엔도르핀(Da Endorphin)'이라는 이름으로 솔로 활동도 병행 중.

3. BEMANI 시리즈의 수록곡

파일:상세 내용 아이콘.svg   자세한 내용은 エンドルフィン 문서
#!if (문단 == null) == (앵커 == null)
를
#!if 문단 != null & 앵커 == null
의 [[エンドルフィン#s-|]]번 문단을
#!if 문단 == null & 앵커 != null
의 [[エンドルフィン#|]][[エンドルフィン#|]] 부분을
참고하십시오.

4. 엔돌핀(인터넷 방송인)

파일:상세 내용 아이콘.svg   자세한 내용은 엔돌핀(인터넷 방송인) 문서
#!if (문단 == null) == (앵커 == null)
를
#!if 문단 != null & 앵커 == null
의 [[엔돌핀(인터넷 방송인)#s-|]]번 문단을
#!if 문단 == null & 앵커 != null
의 [[엔돌핀(인터넷 방송인)#|]][[엔돌핀(인터넷 방송인)#|]] 부분을
참고하십시오.

5. 게임 개발사

파일:상세 내용 아이콘.svg   자세한 내용은 엔돌핀커넥트 문서
#!if (문단 == null) == (앵커 == null)
를
#!if 문단 != null & 앵커 == null
의 [[엔돌핀커넥트#s-|]]번 문단을
#!if 문단 == null & 앵커 != null
의 [[엔돌핀커넥트#|]][[엔돌핀커넥트#|]] 부분을
참고하십시오.

6. 음악 유닛 Endorfin.

파일:상세 내용 아이콘.svg   자세한 내용은 Endorfin. 문서
#!if (문단 == null) == (앵커 == null)
를
#!if 문단 != null & 앵커 == null
의 [[Endorfin.#s-|]]번 문단을
#!if 문단 == null & 앵커 != null
의 [[Endorfin.#|]][[Endorfin.#|]] 부분을
참고하십시오.


[1] 직역하면 체내생성 아편과 같은 펩타이드라는 뜻이다.[2] 몸 안에서 생기는[3] 효능과 관련된 정확한 수치는 아직도 정립되지 않아서, 모르핀의 50배~1000배 사이로 추정한다.[4] 서펜타닐도 모자라고 카펜타닐쯤 와줘야 상대가 된다. 카펜타닐의 진통효과는 모르핀의 10,000배. 모르핀 10kg정도 투여할 것을 카펜타닐 1g정도면 해결할 수 있다는 소리다. 물론 모르핀 10kg를 투여하면 치사량을 아득히 뛰어넘고도 남겠지만.[5] 정확히는 매우 큰 분자량으로 인해, 쓸데없이 뇌 밖으로 나가지 못해서 낭비되지 않는 것.[6] 만일 기준이 널널했으면 다친것도 못느끼고 죽거나 쾌락을 느끼기 위해 자해를 반복하다 죽는 등 생존에 문제가 생겼을 것이다.[7] 대신 외부에서 모르핀을 투여해 수술 직전까지 최대한 환자의 고통을 줄인다.[8] 세로토닌나온다.[9] 자해를 하는 사람들이 '이런 짓을 하면 스트레스가 풀리고 정신이 맑아지는 것 같아서 못 끊는다'라는 얘기를 많이 하는데 분비기전에 이상이 생겨서 엔도르핀이 비정상적으로 나오는 데 중독된 것이다.[10] 멜라닌이 부족한 피부색과도 상관이 있지만, 기본적으로 북유럽은 위도나 흐린 날이 많은 기후 때문에 일조량이 부족하다. 햇볕이 충분한 동아시아, 동남아시아, 아프리카, 남태평양 등지와는 다를 수밖에 없다.[11] 굳이 병원에 와서 자살시도를 한 이유는 빠른 CPR과 재세동으로 생존 가능성이 상대적으로 높기 때문이었다.[12] 그 와중에 하우스는 이에 감명받아 자신도 경험해보기 위해 스스로를 감전시켜 심장이 멈추도록 유도한다. 미리 호출해둔 앰버가 사무실에 쓰러져있는 하우스를 발견하여 재세동에 성공한다.


#!if version2 == null
{{{#!wiki style="border:1px solid gray;border-top:5px solid gray;padding:7px;margin-bottom:0px"
[[크리에이티브 커먼즈 라이선스|[[파일:CC-white.svg|width=22.5px]]]] 이 문서의 내용 중 전체 또는 일부는 {{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/토플리스|토플리스]]}}}{{{#!if external != "o"
[[토플리스]]}}}}}} 문서의 {{{#!if uuid == null
'''uuid not found'''}}}{{{#!if uuid != null
[[https://namu.wiki/w/토플리스?uuid=ccb6f2c9-996c-4a32-9877-316d5e7d293a|r164]]}}} 판{{{#!if paragraph != null
, [[https://namu.wiki/w/토플리스?uuid=ccb6f2c9-996c-4a32-9877-316d5e7d293a#s-|번 문단]]}}}에서 가져왔습니다. [[https://namu.wiki/history/토플리스?from=164|이전 역사 보러 가기]]}}}
#!if version2 != null
{{{#!wiki style="display: block;"
{{{#!wiki style="border:1px solid gray;border-top:5px solid gray;padding:7px;margin-bottom:0px"
[[크리에이티브 커먼즈 라이선스|[[파일:CC-white.svg|width=22.5px]]]] 이 문서의 내용 중 전체 또는 일부는 다른 문서에서 가져왔습니다.
{{{#!wiki style="text-align: center"
{{{#!folding [ 펼치기 · 접기 ]
{{{#!wiki style="text-align: left; padding: 0px 10px"
{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/토플리스|토플리스]]}}}{{{#!if external != "o"
[[토플리스]]}}}}}} 문서의 {{{#!if uuid == null
'''uuid not found'''}}}{{{#!if uuid != null
[[https://namu.wiki/w/토플리스?uuid=ccb6f2c9-996c-4a32-9877-316d5e7d293a|r164]]}}} 판{{{#!if paragraph != null
, [[https://namu.wiki/w/토플리스?uuid=ccb6f2c9-996c-4a32-9877-316d5e7d293a#s-|번 문단]]}}} ([[https://namu.wiki/history/토플리스?from=164|이전 역사]])
{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid2 == null
'''uuid2 not found'''}}}{{{#!if uuid2 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph2 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]]){{{#!if version3 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid3 == null
'''uuid3 not found'''}}}{{{#!if uuid3 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph3 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version4 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid4 == null
'''uuid4 not found'''}}}{{{#!if uuid4 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph4 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version5 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid5 == null
'''uuid5 not found'''}}}{{{#!if uuid5 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph5 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version6 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid6 == null
'''uuid6 not found'''}}}{{{#!if uuid6 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph6 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version7 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid7 == null
'''uuid7 not found'''}}}{{{#!if uuid7 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph7 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version8 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid8 == null
'''uuid8 not found'''}}}{{{#!if uuid8 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph8 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version9 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid9 == null
'''uuid9 not found'''}}}{{{#!if uuid9 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph9 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version10 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid10 == null
'''uuid10 not found'''}}}{{{#!if uuid10 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph10 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version11 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid11 == null
'''uuid11 not found'''}}}{{{#!if uuid11 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph11 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version12 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid12 == null
'''uuid12 not found'''}}}{{{#!if uuid12 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph12 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version13 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid13 == null
'''uuid13 not found'''}}}{{{#!if uuid13 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph13 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version14 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid14 == null
'''uuid14 not found'''}}}{{{#!if uuid14 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph14 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version15 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid15 == null
'''uuid15 not found'''}}}{{{#!if uuid15 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph15 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version16 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid16 == null
'''uuid16 not found'''}}}{{{#!if uuid16 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph16 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version17 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid17 == null
'''uuid17 not found'''}}}{{{#!if uuid17 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph17 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version18 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid18 == null
'''uuid18 not found'''}}}{{{#!if uuid18 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph18 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version19 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid19 == null
'''uuid19 not found'''}}}{{{#!if uuid19 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph19 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version20 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid20 == null
'''uuid20 not found'''}}}{{{#!if uuid20 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph20 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version21 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid21 == null
'''uuid21 not found'''}}}{{{#!if uuid21 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph21 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version22 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid22 == null
'''uuid22 not found'''}}}{{{#!if uuid22 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph22 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version23 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid23 == null
'''uuid23 not found'''}}}{{{#!if uuid23 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph23 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version24 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid24 == null
'''uuid24 not found'''}}}{{{#!if uuid24 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph24 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version25 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid25 == null
'''uuid25 not found'''}}}{{{#!if uuid25 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph25 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version26 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid26 == null
'''uuid26 not found'''}}}{{{#!if uuid26 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph26 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version27 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid27 == null
'''uuid27 not found'''}}}{{{#!if uuid27 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph27 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version28 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid28 == null
'''uuid28 not found'''}}}{{{#!if uuid28 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph28 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version29 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid29 == null
'''uuid29 not found'''}}}{{{#!if uuid29 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph29 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version30 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid30 == null
'''uuid30 not found'''}}}{{{#!if uuid30 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph30 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version31 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid31 == null
'''uuid31 not found'''}}}{{{#!if uuid31 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph31 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version32 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid32 == null
'''uuid32 not found'''}}}{{{#!if uuid32 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph32 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version33 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid33 == null
'''uuid33 not found'''}}}{{{#!if uuid33 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph33 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version34 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid34 == null
'''uuid34 not found'''}}}{{{#!if uuid34 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph34 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version35 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid35 == null
'''uuid35 not found'''}}}{{{#!if uuid35 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph35 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version36 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid36 == null
'''uuid36 not found'''}}}{{{#!if uuid36 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph36 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version37 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid37 == null
'''uuid37 not found'''}}}{{{#!if uuid37 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph37 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version38 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid38 == null
'''uuid38 not found'''}}}{{{#!if uuid38 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph38 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version39 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid39 == null
'''uuid39 not found'''}}}{{{#!if uuid39 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph39 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version40 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid40 == null
'''uuid40 not found'''}}}{{{#!if uuid40 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph40 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version41 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid41 == null
'''uuid41 not found'''}}}{{{#!if uuid41 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph41 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version42 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid42 == null
'''uuid42 not found'''}}}{{{#!if uuid42 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph42 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version43 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid43 == null
'''uuid43 not found'''}}}{{{#!if uuid43 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph43 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version44 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid44 == null
'''uuid44 not found'''}}}{{{#!if uuid44 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph44 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version45 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid45 == null
'''uuid45 not found'''}}}{{{#!if uuid45 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph45 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version46 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid46 == null
'''uuid46 not found'''}}}{{{#!if uuid46 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph46 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version47 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid47 == null
'''uuid47 not found'''}}}{{{#!if uuid47 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph47 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version48 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid48 == null
'''uuid48 not found'''}}}{{{#!if uuid48 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph48 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version49 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid49 == null
'''uuid49 not found'''}}}{{{#!if uuid49 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph49 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}{{{#!if version50 != null
{{{#!wiki style="display: block;"

{{{#!wiki style="display: inline-block"
{{{#!if external == "o"
[[https://namu.wiki/w/|]]}}}{{{#!if external != "o"
[[]]}}}}}} 문서의 {{{#!if uuid50 == null
'''uuid50 not found'''}}}{{{#!if uuid50 != null
[[https://namu.wiki/w/?uuid=|r]]}}} 판{{{#!if paragraph50 != null
, [[https://namu.wiki/w/?uuid=#s-|번 문단]]}}} ([[https://namu.wiki/history/?from=|이전 역사]])}}}}}}}}}}}}}}}}}}}}}